Lineage for d3f58h1 (3f58 H:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7106Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)
  8. 7109Domain d3f58h1: 3f58 H:1-113 [20353]
    Other proteins in same PDB: d3f58h2, d3f58l2

Details for d3f58h1

PDB Entry: 3f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

SCOP Domain Sequences for d3f58h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f58h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

SCOP Domain Coordinates for d3f58h1:

Click to download the PDB-style file with coordinates for d3f58h1.
(The format of our PDB-style files is described here.)

Timeline for d3f58h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f58h2