SCOPe 2.08: Domain d2b1ga2: 2b1g A:201-593

Lineage for d2b1ga2 (2b1g A:201-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins)
   duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs

6. Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [64200] (9 PDB entries)
   Uniprot P31335

8. Domain d2b1ga2: 2b1g A:201-593 [203528]
   Other proteins in same PDB: d2b1ga1, d2b1gb1, d2b1gc1, d2b1gd1
   automated match to d1g8ma2
   complexed with 13a, k, po4

Details for d2b1ga2

PDB Entry: 2b1g, 2.1 Å

PDB Description: crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase

PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d2b1ga2:

Sequence; same for both SEQRES and ATOM records:

>d2b1ga2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

Timeline for d2b1ga2:

• d2b1ga2 first appeared in SCOPe 2.03
  
• d2b1ga2 appears in SCOPe 2.07