SCOP 1.67: Domain d3f58l1: 3f58 L:1-107

Lineage for d3f58l1 (3f58 L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (24 PDB entries)

8. Domain d3f58l1: 3f58 L:1-107 [20352]
   Other proteins in same PDB: d3f58h1, d3f58h2, d3f58l2
   part of anti-gp120 (HIV-1) Fab 58.2
   mutant

Details for d3f58l1

PDB Entry: 3f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

SCOP Domain Sequences for d3f58l1:

Sequence; same for both SEQRES and ATOM records:

>d3f58l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelk

Timeline for d3f58l1:

• d3f58l1 first appeared (with stable ids) in SCOP 1.55
  
• d3f58l1 appears in SCOP 1.65
  
• d3f58l1 appears in SCOP 1.69
  
• d3f58l1 appears in the current release, SCOPe 2.08