Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries) |
Domain d2ax4d_: 2ax4 D: [203512] automated match to d1m7gd_ complexed with adp |
PDB Entry: 2ax4 (more details), 2.5 Å
SCOPe Domain Sequences for d2ax4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ax4d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdnvrh glnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesaglpf feifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvsdcv hqvvellqeqnivpy
Timeline for d2ax4d_: