Lineage for d2ax4d_ (2ax4 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872210Domain d2ax4d_: 2ax4 D: [203512]
    automated match to d1m7gd_
    complexed with adp

Details for d2ax4d_

PDB Entry: 2ax4 (more details), 2.5 Å

PDB Description: Crystal structure of the kinase domain of human 3'-phosphoadenosine 5'-phosphosulphate synthetase 2
PDB Compounds: (D:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2

SCOPe Domain Sequences for d2ax4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ax4d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdnvrh
glnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesaglpf
feifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvsdcv
hqvvellqeqnivpy

SCOPe Domain Coordinates for d2ax4d_:

Click to download the PDB-style file with coordinates for d2ax4d_.
(The format of our PDB-style files is described here.)

Timeline for d2ax4d_: