SCOPe 2.03: Domain d1f58h1: 1f58 H:1-113

Lineage for d1f58h1 (1f58 H:1-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1f58h1: 1f58 H:1-113 [20351]
   Other proteins in same PDB: d1f58h2, d1f58l1, d1f58l2
   part of anti-gp120 (HIV-1) Fab 58.2

Details for d1f58h1

PDB Entry: 1f58, 2 Å

PDB Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323

PDB Compounds: (H:) protein (igg1 antibody 58.2 (heavy chain))

SCOPe Domain Sequences for d1f58h1:

Sequence; same for both SEQRES and ATOM records:

>d1f58h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

Timeline for d1f58h1:

• d1f58h1 first appeared (with stable ids) in SCOP 1.55
  
• d1f58h1 appears in SCOPe 2.02
  
• d1f58h1 appears in SCOPe 2.04
  
• d1f58h1 appears in the current release, SCOPe 2.08