Lineage for d1f58h1 (1f58 H:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287668Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (27 PDB entries)
  8. 287671Domain d1f58h1: 1f58 H:1-113 [20351]
    Other proteins in same PDB: d1f58h2, d1f58l1, d1f58l2
    part of anti-gp120 (HIV-1) Fab 58.2
    mutant

Details for d1f58h1

PDB Entry: 1f58 (more details), 2 Å

PDB Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323

SCOP Domain Sequences for d1f58h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f58h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

SCOP Domain Coordinates for d1f58h1:

Click to download the PDB-style file with coordinates for d1f58h1.
(The format of our PDB-style files is described here.)

Timeline for d1f58h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f58h2