SCOP 1.55: Domain d1f58h1: 1f58 H:1-113

Lineage for d1f58h1 (1f58 H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)

8. Domain d1f58h1: 1f58 H:1-113 [20351]
   Other proteins in same PDB: d1f58h2, d1f58l2

Details for d1f58h1

PDB Entry: 1f58, 2 Å

PDB Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323

SCOP Domain Sequences for d1f58h1:

Sequence; same for both SEQRES and ATOM records:

>d1f58h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

Timeline for d1f58h1:

• d1f58h1 appears in SCOP 1.57
  
• d1f58h1 appears in the current release, SCOPe 2.08