SCOPe 2.04: Domain d2aw5b1: 2aw5 B:15-269

Lineage for d2aw5b1 (2aw5 B:15-269)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225016] (2 PDB entries)

8. Domain d2aw5b1: 2aw5 B:15-269 [203500]
   Other proteins in same PDB: d2aw5a2, d2aw5b2, d2aw5c2
   automated match to d1gq2a2

Details for d2aw5b1

PDB Entry: 2aw5, 2.5 Å

PDB Description: Crystal structure of a human malic enzyme

PDB Compounds: (B:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d2aw5b1:

Sequence; same for both SEQRES and ATOM records:

>d2aw5b1 c.58.1.0 (B:15-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia
svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild
vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr
llnkyrnqyctfndd

Timeline for d2aw5b1:

• d2aw5b1 first appeared in SCOPe 2.03
  
• d2aw5b1 appears in SCOPe 2.05
  
• d2aw5b1 appears in the current release, SCOPe 2.08