Lineage for d2ar7b1 (2ar7 B:4-125,B:162-223)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872112Domain d2ar7b1: 2ar7 B:4-125,B:162-223 [203482]
    Other proteins in same PDB: d2ar7a2, d2ar7a3, d2ar7b2, d2ar7b3
    automated match to d2ak3a1

Details for d2ar7b1

PDB Entry: 2ar7 (more details), 2.15 Å

PDB Description: Crystal structure of human adenylate kinase 4, AK4
PDB Compounds: (B:) Adenylate kinase 4

SCOPe Domain Sequences for d2ar7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ar7b1 c.37.1.0 (B:4-125,B:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
srXdkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
skeay

SCOPe Domain Coordinates for d2ar7b1:

Click to download the PDB-style file with coordinates for d2ar7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ar7b1: