Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d2aj3e1: 2aj3 E:2-107 [203459] Other proteins in same PDB: d2aj3a2, d2aj3c2, d2aj3e2 automated match to d1rhha1 complexed with so4 |
PDB Entry: 2aj3 (more details), 2.03 Å
SCOPe Domain Sequences for d2aj3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj3e1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleis
Timeline for d2aj3e1:
View in 3D Domains from other chains: (mouse over for more information) d2aj3a1, d2aj3a2, d2aj3c1, d2aj3c2 |