Lineage for d2aj3e1 (2aj3 E:2-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765522Domain d2aj3e1: 2aj3 E:2-107 [203459]
    Other proteins in same PDB: d2aj3a2, d2aj3c2, d2aj3e2
    automated match to d1rhha1
    complexed with so4

Details for d2aj3e1

PDB Entry: 2aj3 (more details), 2.03 Å

PDB Description: Crystal Structure of a Cross-Reactive HIV-1 Neutralizing CD4-Binding Site Antibody Fab m18
PDB Compounds: (E:) Fab m18, Light Chain

SCOPe Domain Sequences for d2aj3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj3e1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleis

SCOPe Domain Coordinates for d2aj3e1:

Click to download the PDB-style file with coordinates for d2aj3e1.
(The format of our PDB-style files is described here.)

Timeline for d2aj3e1: