SCOPe 2.04: Domain d2aj3e1: 2aj3 E:2-107

Lineage for d2aj3e1 (2aj3 E:2-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2aj3e1: 2aj3 E:2-107 [203459]
   Other proteins in same PDB: d2aj3a2, d2aj3c2, d2aj3e2
   automated match to d1rhha1
   complexed with so4

Details for d2aj3e1

PDB Entry: 2aj3, 2.03 Å

PDB Description: Crystal Structure of a Cross-Reactive HIV-1 Neutralizing CD4-Binding Site Antibody Fab m18

PDB Compounds: (E:) Fab m18, Light Chain

SCOPe Domain Sequences for d2aj3e1:

Sequence; same for both SEQRES and ATOM records:

>d2aj3e1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleis

Timeline for d2aj3e1:

• d2aj3e1 first appeared in SCOPe 2.03
  
• d2aj3e1 appears in SCOPe 2.05
  
• d2aj3e1 appears in the current release, SCOPe 2.08