SCOP 1.63: Domain d1cftb1: 1cft B:1-112

Lineage for d1cftb1 (1cft B:1-112)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)

8. Domain d1cftb1: 1cft B:1-112 [20345]
   Other proteins in same PDB: d1cfta2, d1cftb2

Details for d1cftb1

PDB Entry: 1cft, 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide

SCOP Domain Sequences for d1cftb1:

Sequence; same for both SEQRES and ATOM records:

>d1cftb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsa

Timeline for d1cftb1:

• d1cftb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cftb1 appears in SCOP 1.61
  
• d1cftb1 appears in SCOP 1.65
  
• d1cftb1 appears in the current release, SCOPe 2.08