SCOP 1.69: Domain d1cfta1: 1cft A:1-107

Lineage for d1cfta1 (1cft A:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1cfta1: 1cft A:1-107 [20344]
   Other proteins in same PDB: d1cfta2, d1cftb1, d1cftb2
   part of anti-gp120 (HIV-1) Fab CB 4-1

Details for d1cfta1

PDB Entry: 1cft, 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide

SCOP Domain Sequences for d1cfta1:

Sequence; same for both SEQRES and ATOM records:

>d1cfta1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1cfta1:

• d1cfta1 first appeared (with stable ids) in SCOP 1.55
  
• d1cfta1 appears in SCOP 1.67
  
• d1cfta1 appears in SCOP 1.71
  
• d1cfta1 appears in the current release, SCOPe 2.08