Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Plasmodium vivax [TaxId:5855] [225043] (2 PDB entries) |
Domain d2aa3b1: 2aa3 B:18-163 [203424] Other proteins in same PDB: d2aa3a2, d2aa3b2, d2aa3c2, d2aa3d2 automated match to d1t26a1 complexed with ap0, so4 |
PDB Entry: 2aa3 (more details), 2.05 Å
SCOPe Domain Sequences for d2aa3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aa3b1 c.2.1.5 (B:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]} tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf iivvtnpvdvmvqllfehsgvpknkiigl
Timeline for d2aa3b1: