SCOPe 2.05: Domain d2a9ca1: 2a9c A:108-343

Lineage for d2a9ca1 (2a9c A:108-343)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif

4. Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families)

5. Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins)
   Pfam PF00174

6. Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56527] (6 PDB entries)

8. Domain d2a9ca1: 2a9c A:108-343 [203410]
   Other proteins in same PDB: d2a9ca2, d2a9cb2
   automated match to d1ogpa2
   complexed with gol, mo, mte, so4; mutant

Details for d2a9ca1

PDB Entry: 2a9c, 2.5 Å

PDB Description: crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d2a9ca1:

Sequence; same for both SEQRES and ATOM records:

>d2a9ca1 d.176.1.1 (A:108-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]}
rvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlrvdgpgggtlslsl
aelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhag
fpeelqgewhvcfegldadpggapygasipygralspaadvllayemngtelprdhgfpv
rvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiq

Timeline for d2a9ca1:

• d2a9ca1 first appeared in SCOPe 2.03
  
• d2a9ca1 appears in SCOPe 2.04
  
• d2a9ca1 appears in SCOPe 2.06
  
• d2a9ca1 appears in the current release, SCOPe 2.08