![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries) |
![]() | Domain d1cfsb1: 1cfs B:1-112 [20341] Other proteins in same PDB: d1cfsa2, d1cfsb2 |
PDB Entry: 1cfs (more details), 2.75 Å
SCOP Domain Sequences for d1cfsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfsb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain} qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsa
Timeline for d1cfsb1: