SCOPe 2.05: Domain d2a92b2: 2a92 B:164-329

Lineage for d2a92b2 (2a92 B:164-329)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (18 species)

7. Species Plasmodium vivax [TaxId:5855] [225044] (2 PDB entries)

8. Domain d2a92b2: 2a92 B:164-329 [203405]
   Other proteins in same PDB: d2a92a1, d2a92b1, d2a92c1, d2a92d1
   automated match to d1t26a2
   complexed with nai

Details for d2a92b2

PDB Entry: 2a92, 2.04 Å

PDB Description: crystal structure of lactate dehydrogenase from plasmodium vivax: complex with nadh

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a92b2:

Sequence; same for both SEQRES and ATOM records:

>d2a92b2 d.162.1.1 (B:164-329) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali

Timeline for d2a92b2:

• d2a92b2 first appeared in SCOPe 2.03
  
• d2a92b2 appears in SCOPe 2.04
  
• d2a92b2 appears in SCOPe 2.06
  
• d2a92b2 appears in the current release, SCOPe 2.08