SCOP 1.61: Domain d1cfsa1: 1cfs A:1-107

Lineage for d1cfsa1 (1cfs A:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)

8. Domain d1cfsa1: 1cfs A:1-107 [20340]
   Other proteins in same PDB: d1cfsa2, d1cfsb2

Details for d1cfsa1

PDB Entry: 1cfs, 2.75 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide

SCOP Domain Sequences for d1cfsa1:

Sequence; same for both SEQRES and ATOM records:

>d1cfsa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1cfsa1:

• d1cfsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cfsa1 appears in SCOP 1.59
  
• d1cfsa1 appears in SCOP 1.63
  
• d1cfsa1 appears in the current release, SCOPe 2.08