SCOPe 2.06: Domain d2a2ad_: 2a2a D:

Lineage for d2a2ad_ (2a2a D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d2a2ad_: 2a2a D: [203387]
   automated match to d1a06a_
   complexed with cl, dtt, gol, na

Details for d2a2ad_

PDB Entry: 2a2a, 1.47 Å

PDB Description: high-resolution crystallographic analysis of the autoinhibited conformation of a human death-associated protein kinase

PDB Compounds: (D:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2a2ad_:

Sequence; same for both SEQRES and ATOM records:

>d2a2ad_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
shtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
rrr

Timeline for d2a2ad_:

• d2a2ad_ first appeared in SCOPe 2.03
  
• d2a2ad_ appears in SCOPe 2.05
  
• d2a2ad_ appears in SCOPe 2.07
  
• d2a2ad_ appears in the current release, SCOPe 2.08