SCOPe 2.06: Domain d2a03b1: 2a03 B:1-84

Lineage for d2a03b1 (2a03 B:1-84)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5821] [224986] (1 PDB entry)

8. Domain d2a03b1: 2a03 B:1-84 [203382]
   Other proteins in same PDB: d2a03a2, d2a03b2
   automated match to d1dt0a1
   complexed with mn, zn

Details for d2a03b1

PDB Entry: 2a03, 2.33 Å

PDB Description: superoxide dismutase protein from plasmodium berghei

PDB Compounds: (B:) Fe-superoxide dismutase homolog

SCOPe Domain Sequences for d2a03b1:

Sequence; same for both SEQRES and ATOM records:

>d2a03b1 a.2.11.0 (B:1-84) automated matches {Plasmodium berghei [TaxId: 5821]}
maitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkes
tgaifnnaaqiwnhsfywdsmgpn

Timeline for d2a03b1:

• d2a03b1 first appeared in SCOPe 2.03
  
• d2a03b1 appears in SCOPe 2.05
  
• d2a03b1 appears in SCOPe 2.07
  
• d2a03b1 appears in the current release, SCOPe 2.08