SCOP 1.67: Domain d1cfqa1: 1cfq A:1-107

Lineage for d1cfqa1 (1cfq A:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1cfqa1: 1cfq A:1-107 [20338]
   Other proteins in same PDB: d1cfqa2, d1cfqb1, d1cfqb2
   part of anti-gp120 (HIV-1) Fab CB 4-1

Details for d1cfqa1

PDB Entry: 1cfq, 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41

SCOP Domain Sequences for d1cfqa1:

Sequence; same for both SEQRES and ATOM records:

>d1cfqa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1cfqa1:

• d1cfqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cfqa1 appears in SCOP 1.65
  
• d1cfqa1 appears in SCOP 1.69
  
• d1cfqa1 appears in the current release, SCOPe 2.08