Lineage for d1cfqa1 (1cfq A:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51798Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)
  8. 51801Domain d1cfqa1: 1cfq A:1-107 [20338]
    Other proteins in same PDB: d1cfqa2, d1cfqb2

Details for d1cfqa1

PDB Entry: 1cfq (more details), 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41

SCOP Domain Sequences for d1cfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfqa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

SCOP Domain Coordinates for d1cfqa1:

Click to download the PDB-style file with coordinates for d1cfqa1.
(The format of our PDB-style files is described here.)

Timeline for d1cfqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfqa2