SCOP 1.55: Domain d1cfqa1: 1cfq A:1-107

Lineage for d1cfqa1 (1cfq A:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)

8. Domain d1cfqa1: 1cfq A:1-107 [20338]
   Other proteins in same PDB: d1cfqa2, d1cfqb2

Details for d1cfqa1

PDB Entry: 1cfq, 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41

SCOP Domain Sequences for d1cfqa1:

Sequence; same for both SEQRES and ATOM records:

>d1cfqa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1cfqa1:

• d1cfqa1 appears in SCOP 1.57
  
• d1cfqa1 appears in the current release, SCOPe 2.08