Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries) |
Domain d1cfqa1: 1cfq A:1-107 [20338] Other proteins in same PDB: d1cfqa2, d1cfqb2 |
PDB Entry: 1cfq (more details), 2.8 Å
SCOP Domain Sequences for d1cfqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfqa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain} dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk
Timeline for d1cfqa1: