![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (16 species) not a true protein |
![]() | Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry) |
![]() | Domain d1zzhd1: 1zzh D:4-169 [203378] automated match to d1nmla1 complexed with ca, hec, zn |
PDB Entry: 1zzh (more details), 2.7 Å
SCOPe Domain Sequences for d1zzhd1:
Sequence, based on SEQRES records: (download)
>d1zzhd1 a.3.1.0 (D:4-169) automated matches {Rhodobacter capsulatus [TaxId: 1061]} alreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnvglg gvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnntpe nlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitp
>d1zzhd1 a.3.1.0 (D:4-169) automated matches {Rhodobacter capsulatus [TaxId: 1061]} alreeakglfevipmqapqvtrdkidlgamlffdprmsksgvfscqschnvglggvdgle tsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyvea fakafpgqkdpisfdnfalaveafeatlitp
Timeline for d1zzhd1: