SCOP 1.73: Domain d1hi6a1: 1hi6 A:1-107

Lineage for d1hi6a1 (1hi6 A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1hi6a1: 1hi6 A:1-107 [20336]
   Other proteins in same PDB: d1hi6a2, d1hi6b1, d1hi6b2
   part of anti-gp120 (HIV-1) Fab CB 4-1
   complexed with nh2

Details for d1hi6a1

PDB Entry: 1hi6, 2.55 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

PDB Compounds: (A:) igg2a kappa antibody cb41 (light chain)

SCOP Domain Sequences for d1hi6a1:

Sequence; same for both SEQRES and ATOM records:

>d1hi6a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1hi6a1:

• d1hi6a1 first appeared (with stable ids) in SCOP 1.55
  
• d1hi6a1 appears in SCOP 1.71
  
• d1hi6a1 appears in SCOP 1.75
  
• d1hi6a1 appears in the current release, SCOPe 2.08