SCOPe 2.05: Domain d1zkaa_: 1zka A:

Lineage for d1zkaa_ (1zka A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein automated matches [226855] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)

8. Domain d1zkaa_: 1zka A: [203339]
   automated match to d1my7a_
   mutant

Details for d1zkaa_

PDB Entry: 1zka, 2.2 Å

PDB Description: nf-kb relb forms an intertwined homodimer, y300s mutant

PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d1zkaa_:

Sequence; same for both SEQRES and ATOM records:

>d1zkaa_ b.1.18.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvprgshmntselricrinkesgpctggeelsllcdkvqkedisvvfstaswegradfsq
advhrqiaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr

Timeline for d1zkaa_:

• d1zkaa_ first appeared in SCOPe 2.03
  
• d1zkaa_ appears in SCOPe 2.04
  
• d1zkaa_ is called d1zkaa1 in SCOPe 2.06
  
• d1zkaa_ appears in the current release, SCOPe 2.08, called d1zkaa1