SCOP 1.55: Domain d1blnd1: 1bln D:1-113

Lineage for d1blnd1 (1bln D:1-113)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [48871] (1 PDB entry)
Domain d1blnd1: 1bln D:1-113 [20333]
Other proteins in same PDB: d1blna2, d1blnb2, d1blnc2, d1blnd2

Details for d1blnd1

PDB Entry: 1bln (more details), 2.8 Å

PDB Description: anti-p-glycoprotein fab mrk-16

SCOP Domain Sequences for d1blnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blnd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
evilvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
pdsvkgrftisrdnaknnlylqmsslrsedtalyycaryyryeawfaswgqgtlvtvsa

SCOP Domain Coordinates for d1blnd1:

Click to download the PDB-style file with coordinates for d1blnd1.
(The format of our PDB-style files is described here.)

Timeline for d1blnd1: