| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [48871] (1 PDB entry) |
| Domain d1blnd1: 1bln D:1-113 [20333] Other proteins in same PDB: d1blna2, d1blnb2, d1blnc2, d1blnd2 |
PDB Entry: 1bln (more details), 2.8 Å
SCOP Domain Sequences for d1blnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blnd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
evilvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
pdsvkgrftisrdnaknnlylqmsslrsedtalyycaryyryeawfaswgqgtlvtvsa
Timeline for d1blnd1: