Lineage for d1blnd1 (1bln D:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7141Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [48871] (1 PDB entry)
  8. 7145Domain d1blnd1: 1bln D:1-113 [20333]
    Other proteins in same PDB: d1blna2, d1blnb2, d1blnc2, d1blnd2

Details for d1blnd1

PDB Entry: 1bln (more details), 2.8 Å

PDB Description: anti-p-glycoprotein fab mrk-16

SCOP Domain Sequences for d1blnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blnd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
evilvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
pdsvkgrftisrdnaknnlylqmsslrsedtalyycaryyryeawfaswgqgtlvtvsa

SCOP Domain Coordinates for d1blnd1:

Click to download the PDB-style file with coordinates for d1blnd1.
(The format of our PDB-style files is described here.)

Timeline for d1blnd1: