SCOPe 2.04: Domain d1zgja1: 1zgj A:11-116

Lineage for d1zgja1 (1zgj A:11-116)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries)

8. Domain d1zgja1: 1zgj A:11-116 [203326]
   Other proteins in same PDB: d1zgja2
   automated match to d1fp2a1
   complexed with p1s, sah

Details for d1zgja1

PDB Entry: 1zgj, 2.5 Å

PDB Description: Crystal structure of isoflavanone 4'-O-methyltransferase complexed with (+)-pisatin

PDB Compounds: (A:) Isoflavanone 4'-O-methyltransferase'

SCOPe Domain Sequences for d1zgja1:

Sequence; same for both SEQRES and ATOM records:

>d1zgja1 a.4.5.0 (A:11-116) automated matches {Medicago truncatula [TaxId: 3880]}
selyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhpskvni
lhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkp

Timeline for d1zgja1:

• d1zgja1 first appeared in SCOPe 2.03
  
• d1zgja1 appears in SCOPe 2.05
  
• d1zgja1 appears in the current release, SCOPe 2.08