Lineage for d1zgja1 (1zgj A:11-116)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694898Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries)
  8. 2694901Domain d1zgja1: 1zgj A:11-116 [203326]
    Other proteins in same PDB: d1zgja2
    automated match to d1fp2a1
    complexed with p1s, sah

Details for d1zgja1

PDB Entry: 1zgj (more details), 2.5 Å

PDB Description: Crystal structure of isoflavanone 4'-O-methyltransferase complexed with (+)-pisatin
PDB Compounds: (A:) Isoflavanone 4'-O-methyltransferase'

SCOPe Domain Sequences for d1zgja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgja1 a.4.5.0 (A:11-116) automated matches {Medicago truncatula [TaxId: 3880]}
selyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhpskvni
lhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkp

SCOPe Domain Coordinates for d1zgja1:

Click to download the PDB-style file with coordinates for d1zgja1.
(The format of our PDB-style files is described here.)

Timeline for d1zgja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgja2