SCOPe 2.08: Domain d1zg3a2: 1zg3 A:117-364

Lineage for d1zg3a2 (1zg3 A:117-364)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [225108] (10 PDB entries)

8. Domain d1zg3a2: 1zg3 A:117-364 [203322]
   Other proteins in same PDB: d1zg3a1
   automated match to d1fp2a2
   complexed with 2hi, sah

Details for d1zg3a2

PDB Entry: 1zg3, 2.35 Å

PDB Description: Crystal structure of the isoflavanone 4'-O-methyltransferase complexed with SAH and 2,7,4'-trihydroxyisoflavanone

PDB Compounds: (A:) isoflavanone 4'-O-methyltransferase

SCOPe Domain Sequences for d1zg3a2:

Sequence; same for both SEQRES and ATOM records:

>d1zg3a2 c.66.1.0 (A:117-364) automated matches {Medicago truncatula [TaxId: 3880]}
tclssivkgalhpssldmwssskkwfnedkeqtlfecatgesfwdflnkdsesstlsmfq
damasdsrmfklvlqenkrvfegleslvdvgggtggvtkliheifphlkctvfdqpqvvg
nltgnenlnfvggdmfksipsadavllkwvlhdwndeqslkilknskeaishkgkdgkvi
iidisidetsddrgltelqldydlvmltmflgkertkqewekliydagfssykitpisgf
kslievyp

Timeline for d1zg3a2:

• d1zg3a2 first appeared in SCOPe 2.03
  
• d1zg3a2 appears in SCOPe 2.07