SCOPe 2.08: Domain d1z82b1: 1z82 B:3-166

Lineage for d1z82b1 (1z82 B:3-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries)

8. Domain d1z82b1: 1z82 B:3-166 [203306]
   Other proteins in same PDB: d1z82a2, d1z82b2
   automated match to d1evya2
   complexed with g3h, g3p, mpd, mrd, ndp

Details for d1z82b1

PDB Entry: 1z82, 2 Å

PDB Description: crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution

PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1z82b1:

Sequence; same for both SEQRES and ATOM records:

>d1z82b1 c.2.1.0 (B:3-166) automated matches {Thermotoga maritima [TaxId: 243274]}
mrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtspyveeskitvratnd
leeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgkrvseiveeilgcpy
avlsgpshaeevakklptavtlagenskelqkristeyfrvytc

Timeline for d1z82b1:

• d1z82b1 first appeared in SCOPe 2.03
  
• d1z82b1 appears in SCOPe 2.07