SCOPe 2.06: Domain d1z4sd1: 1z4s D:1G-137

Lineage for d1z4sd1 (1z4s D:1G-137)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1z4sd1: 1z4s D:1G-137 [203300]
   Other proteins in same PDB: d1z4sa2, d1z4sb2, d1z4sc2, d1z4sd2
   automated match to d1q03a_
   complexed with so4; mutant

Details for d1z4sd1

PDB Entry: 1z4s, 2.6 Å

PDB Description: Crystal Structure of Gly19 and Glu60 deletion mutant of Human Acidic Fibroblast Growth Factor

PDB Compounds: (D:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1z4sd1:

Sequence; same for both SEQRES and ATOM records:

>d1z4sd1 b.42.1.1 (D:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyiksttg
qylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgpr
thygqkailflplpv

Timeline for d1z4sd1:

• d1z4sd1 first appeared in SCOPe 2.03, called d1z4sd_
  
• d1z4sd1 was called d1z4sd_ in SCOPe 2.05
  
• d1z4sd1 appears in SCOPe 2.07
  
• d1z4sd1 appears in the current release, SCOPe 2.08