SCOPe 2.08: Domain d1z1fa2: 1z1f A:236-389

Lineage for d1z1fa2 (1z1f A:236-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [225012] (2 PDB entries)

8. Domain d1z1fa2: 1z1f A:236-389 [203294]
   Other proteins in same PDB: d1z1fa1
   automated match to d1bi5a2
   complexed with cit, stl

Details for d1z1fa2

PDB Entry: 1z1f, 2.9 Å

PDB Description: Crystal structure of stilbene synthase from Arachis hypogaea (resveratrol-bound form)

PDB Compounds: (A:) stilbene synthase

SCOPe Domain Sequences for d1z1fa2:

Sequence; same for both SEQRES and ATOM records:

>d1z1fa2 c.95.1.0 (A:236-389) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
lfeivstdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdy
nsifwiahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksle
aglkttgegldwgvlfgfgpgltietvvlrsmai

Timeline for d1z1fa2:

• d1z1fa2 first appeared in SCOPe 2.03
  
• d1z1fa2 appears in SCOPe 2.07