Lineage for d1z0ga_ (1z0g A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177074Species Archaeoglobus fulgidus [TaxId:2234] [225000] (7 PDB entries)
  8. 2177084Domain d1z0ga_: 1z0g A: [203276]
    automated match to d1xhka_

Details for d1z0ga_

PDB Entry: 1z0g (more details), 2.27 Å

PDB Description: crystal structure of a. fulgidus lon proteolytic domain
PDB Compounds: (A:) Putative protease La homolog type

SCOPe Domain Sequences for d1z0ga_:

Sequence, based on SEQRES records: (download)

>d1z0ga_ d.14.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
ehvledgkkknrlmskfk

Sequence, based on observed residues (ATOM records): (download)

>d1z0ga_ d.14.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
ledgkkknrlmskfk

SCOPe Domain Coordinates for d1z0ga_:

Click to download the PDB-style file with coordinates for d1z0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1z0ga_: