Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (16 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [225000] (7 PDB entries) |
Domain d1z0ba_: 1z0b A: [203268] automated match to d1xhka_ complexed with ca; mutant |
PDB Entry: 1z0b (more details), 1.55 Å
SCOPe Domain Sequences for d1z0ba_:
Sequence, based on SEQRES records: (download)
>d1z0ba_ d.14.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} yklfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavm nvsaiikkytgrdisnmdvhiqfvgtyegvagdsasisiatavisaiegipvdqsvamtg slsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinev lehvledgkkknrlmskfkelelaav
>d1z0ba_ d.14.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} yklfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvs aiikkytgrdisnmdvhiqfvgtyegvagdsasisiatavisaiegipvdqsvamtgsls vkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevleh vledgkkknrlmskfkelelaav
Timeline for d1z0ba_: