Lineage for d1ysla2 (1ysl A:168-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917624Species Enterococcus faecalis [TaxId:1351] [225035] (1 PDB entry)
  8. 2917626Domain d1ysla2: 1ysl A:168-383 [203221]
    automated match to d1xpma2
    complexed with aae, coa, gol, so4

Details for d1ysla2

PDB Entry: 1ysl (more details), 1.9 Å

PDB Description: Crystal structure of HMG-CoA synthase from Enterococcus faecalis with AcetoAcetyl-CoA ligand.
PDB Compounds: (A:) HMG-CoA synthase

SCOPe Domain Sequences for d1ysla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysla2 c.95.1.0 (A:168-383) automated matches {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn

SCOPe Domain Coordinates for d1ysla2:

Click to download the PDB-style file with coordinates for d1ysla2.
(The format of our PDB-style files is described here.)

Timeline for d1ysla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysla1