Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species VEGF neutralizing Fab-12 (mouse), kappa L chain [48870] (2 PDB entries) |
Domain d1bj1l1: 1bj1 L:1-107 [20322] Other proteins in same PDB: d1bj1h2, d1bj1j2, d1bj1k2, d1bj1l2, d1bj1v_, d1bj1w_ |
PDB Entry: 1bj1 (more details), 2.4 Å
SCOP Domain Sequences for d1bj1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj1l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain} diqmtqspsslsasvgdrvtitcsasqdisnylnwyqqkpgkapkvliyftsslhsgvps rfsgsgsgtdftltisslqpedfatyycqqystvpwtfgqgtkveik
Timeline for d1bj1l1: