Lineage for d1beyl1 (1bey L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289486Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)
  8. 1289502Domain d1beyl1: 1bey L:1-107 [20320]
    Other proteins in same PDB: d1beyh1, d1beyh2, d1beyl2
    part of antibody to CAMPATH-1H humanized Fab

Details for d1beyl1

PDB Entry: 1bey (more details), 3.25 Å

PDB Description: antibody to campath-1h humanized fab
PDB Compounds: (L:) campath-1h antibody

SCOPe Domain Sequences for d1beyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beyl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveik

SCOPe Domain Coordinates for d1beyl1:

Click to download the PDB-style file with coordinates for d1beyl1.
(The format of our PDB-style files is described here.)

Timeline for d1beyl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beyl2