SCOP 1.57: Domain d1beyl1: 1bey L:1-107

Lineage for d1beyl1 (1bey L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Antibody to CAMPATH-1H humanized fab, kappa L chain [48869] (1 PDB entry)

8. Domain d1beyl1: 1bey L:1-107 [20320]
   Other proteins in same PDB: d1beyh2, d1beyl2

Details for d1beyl1

PDB Entry: 1bey, 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyl1:

Sequence; same for both SEQRES and ATOM records:

>d1beyl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveik

Timeline for d1beyl1:

• d1beyl1 first appeared (with stable ids) in SCOP 1.55
  
• d1beyl1 appears in SCOP 1.59
  
• d1beyl1 appears in the current release, SCOPe 2.08