SCOPe 2.04: Domain d1yhmc_: 1yhm C:

Lineage for d1yhmc_ (1yhm C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (27 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196823] (14 PDB entries)

8. Domain d1yhmc_: 1yhm C: [203191]
   automated match to d4dwba_
   complexed with ahd, ipe, mg, so4

Details for d1yhmc_

PDB Entry: 1yhm, 2.5 Å

PDB Description: structure of the complex of trypanosoma cruzi farnesyl disphosphate synthase with alendronate, isopentenyl diphosphate and mg+2

PDB Compounds: (C:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d1yhmc_:

Sequence; same for both SEQRES and ATOM records:

>d1yhmc_ a.128.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

Timeline for d1yhmc_:

• d1yhmc_ first appeared in SCOPe 2.03
  
• d1yhmc_ appears in SCOPe 2.05
  
• d1yhmc_ appears in the current release, SCOPe 2.08