Lineage for d1ce1h1 (1ce1 H:1-121)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287724Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (7 PDB entries)
  8. 287727Domain d1ce1h1: 1ce1 H:1-121 [20319]
    Other proteins in same PDB: d1ce1h2, d1ce1l1, d1ce1l2
    part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1h1

PDB Entry: 1ce1 (more details), 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen

SCOP Domain Sequences for d1ce1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce1h1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
s

SCOP Domain Coordinates for d1ce1h1:

Click to download the PDB-style file with coordinates for d1ce1h1.
(The format of our PDB-style files is described here.)

Timeline for d1ce1h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ce1h2