Lineage for d1ygaa_ (1yga A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309200Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1309590Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 1309591Protein automated matches [226849] (1 species)
    not a true protein
  7. 1309592Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [224957] (1 PDB entry)
  8. 1309593Domain d1ygaa_: 1yga A: [203185]
    automated match to d1lura_

Details for d1ygaa_

PDB Entry: 1yga (more details), 2 Å

PDB Description: crystal structure of saccharomyces cerevisiae yn9a protein, new york structural genomics consortium
PDB Compounds: (A:) Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region

SCOPe Domain Sequences for d1ygaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygaa_ b.30.5.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmgatvgry
anriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvvefklld
dhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfnlnkvks
eksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfdctfiid
ankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvprsgfav
qqgryvdainrdewrgcvllkrgevytsktqykfdi

SCOPe Domain Coordinates for d1ygaa_:

Click to download the PDB-style file with coordinates for d1ygaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ygaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ygab_