SCOP 1.63: Domain d1ce1l1: 1ce1 L:1-107

Lineage for d1ce1l1 (1ce1 L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain [48868] (1 PDB entry)

8. Domain d1ce1l1: 1ce1 L:1-107 [20318]
   Other proteins in same PDB: d1ce1h2, d1ce1l2

Details for d1ce1l1

PDB Entry: 1ce1, 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen

SCOP Domain Sequences for d1ce1l1:

Sequence; same for both SEQRES and ATOM records:

>d1ce1l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain}
diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveik

Timeline for d1ce1l1:

• d1ce1l1 first appeared (with stable ids) in SCOP 1.55
  
• d1ce1l1 appears in SCOP 1.61
  
• d1ce1l1 appears in SCOP 1.65
  
• d1ce1l1 appears in the current release, SCOPe 2.08