Class g: Small proteins [56992] (94 folds) |
Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
Superfamily g.19.1: Crisp domain-like [57546] (3 families) |
Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
Protein automated matches [226858] (4 species) not a true protein |
Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries) |
Domain d1xx5b2: 1xx5 B:165-221 [203176] Other proteins in same PDB: d1xx5a1, d1xx5b1, d1xx5c1 automated match to d1rc9a2 complexed with eoh |
PDB Entry: 1xx5 (more details), 2.4 Å
SCOPe Domain Sequences for d1xx5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx5b2 g.19.1.0 (B:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii
Timeline for d1xx5b2:
View in 3D Domains from other chains: (mouse over for more information) d1xx5a1, d1xx5a2, d1xx5c1, d1xx5c2 |