Lineage for d1xx5b2 (1xx5 B:165-221)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261052Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 2261053Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 2261066Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 2261067Protein automated matches [226858] (4 species)
    not a true protein
  7. 2261068Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)
  8. 2261076Domain d1xx5b2: 1xx5 B:165-221 [203176]
    Other proteins in same PDB: d1xx5a1, d1xx5b1, d1xx5c1
    automated match to d1rc9a2
    complexed with eoh

Details for d1xx5b2

PDB Entry: 1xx5 (more details), 2.4 Å

PDB Description: Crystal Structure of Natrin from Naja atra snake venom
PDB Compounds: (B:) Natrin 1

SCOPe Domain Sequences for d1xx5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx5b2 g.19.1.0 (B:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

SCOPe Domain Coordinates for d1xx5b2:

Click to download the PDB-style file with coordinates for d1xx5b2.
(The format of our PDB-style files is described here.)

Timeline for d1xx5b2: