SCOPe 2.08: Domain d1xx5b2: 1xx5 B:165-221

Lineage for d1xx5b2 (1xx5 B:165-221)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (5 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)

8. Domain d1xx5b2: 1xx5 B:165-221 [203176]
   Other proteins in same PDB: d1xx5a1, d1xx5b1, d1xx5c1
   automated match to d1rc9a2
   complexed with eoh

Details for d1xx5b2

PDB Entry: 1xx5, 2.4 Å

PDB Description: Crystal Structure of Natrin from Naja atra snake venom

PDB Compounds: (B:) Natrin 1

SCOPe Domain Sequences for d1xx5b2:

Sequence; same for both SEQRES and ATOM records:

>d1xx5b2 g.19.1.0 (B:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

Timeline for d1xx5b2:

• d1xx5b2 first appeared in SCOPe 2.03
  
• d1xx5b2 appears in SCOPe 2.07