Lineage for d1xx5a1 (1xx5 A:6-164)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923144Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1923145Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1923146Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 1923159Protein automated matches [194852] (3 species)
    not a true protein
  7. 1923160Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)
  8. 1923167Domain d1xx5a1: 1xx5 A:6-164 [203173]
    Other proteins in same PDB: d1xx5a2, d1xx5b2, d1xx5c2
    automated match to d1rc9a1
    complexed with eoh

Details for d1xx5a1

PDB Entry: 1xx5 (more details), 2.4 Å

PDB Description: Crystal Structure of Natrin from Naja atra snake venom
PDB Compounds: (A:) Natrin 1

SCOPe Domain Sequences for d1xx5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx5a1 d.111.1.1 (A:6-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
ragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

SCOPe Domain Coordinates for d1xx5a1:

Click to download the PDB-style file with coordinates for d1xx5a1.
(The format of our PDB-style files is described here.)

Timeline for d1xx5a1: