Lineage for d1xtab1 (1xta B:3-164)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428408Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1428409Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1428410Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 1428423Protein automated matches [194852] (3 species)
    not a true protein
  7. 1428424Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)
  8. 1428426Domain d1xtab1: 1xta B:3-164 [203161]
    Other proteins in same PDB: d1xtaa2, d1xtab2
    automated match to d1rc9a1

Details for d1xtab1

PDB Entry: 1xta (more details), 1.58 Å

PDB Description: Crystal Structure of Natrin, a snake venom CRISP from Taiwan cobra (Naja atra)
PDB Compounds: (B:) Natrin 1

SCOPe Domain Sequences for d1xtab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtab1 d.111.1.1 (B:3-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
dfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhsp
dnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqivwy
qtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

SCOPe Domain Coordinates for d1xtab1:

Click to download the PDB-style file with coordinates for d1xtab1.
(The format of our PDB-style files is described here.)

Timeline for d1xtab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtab2