Lineage for d1bfog1 (1bfo G:1-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 931221Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)
  8. 931228Domain d1bfog1: 1bfo G:1-107 [20316]
    Other proteins in same PDB: d1bfoa2, d1bfob1, d1bfob2, d1bfoc2, d1bfod1, d1bfod2, d1bfoe2, d1bfof1, d1bfof2, d1bfog2, d1bfoh1, d1bfoh2
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfog1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab
PDB Compounds: (G:) campath-1g antibody

SCOPe Domain Sequences for d1bfog1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfog1 b.1.1.1 (G:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

SCOPe Domain Coordinates for d1bfog1:

Click to download the PDB-style file with coordinates for d1bfog1.
(The format of our PDB-style files is described here.)

Timeline for d1bfog1: