Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (30 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224994] (2 PDB entries) |
Domain d1xreb2: 1xre B:93-203 [203158] Other proteins in same PDB: d1xrea1, d1xreb1 automated match to d1jr9a2 complexed with mn |
PDB Entry: 1xre (more details), 1.8 Å
SCOPe Domain Sequences for d1xreb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xreb2 d.44.1.0 (B:93-203) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} rgggepngdvakvidyyfntfdnlkdqlskaaisrfgsgygwlvldgeelsvmstpnqdt plqegkipllvidvwehayylkyqnrrpefvtnwwhtvnwdrvnekylqai
Timeline for d1xreb2: