Lineage for d1xreb2 (1xre B:93-203)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903883Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224994] (2 PDB entries)
  8. 1903885Domain d1xreb2: 1xre B:93-203 [203158]
    Other proteins in same PDB: d1xrea1, d1xreb1
    automated match to d1jr9a2
    complexed with mn

Details for d1xreb2

PDB Entry: 1xre (more details), 1.8 Å

PDB Description: Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1xreb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xreb2 d.44.1.0 (B:93-203) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
rgggepngdvakvidyyfntfdnlkdqlskaaisrfgsgygwlvldgeelsvmstpnqdt
plqegkipllvidvwehayylkyqnrrpefvtnwwhtvnwdrvnekylqai

SCOPe Domain Coordinates for d1xreb2:

Click to download the PDB-style file with coordinates for d1xreb2.
(The format of our PDB-style files is described here.)

Timeline for d1xreb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xreb1